Newswise Feature Channel: Healthspan /articles/channels/Healthspan This feature channel highlights experts, research, and feature stories related to aging. en-us Copyright 2024 Newswise Newswise Feature Channel: Healthspan 115 31 / /images/newswise-logo-rss.gif Singapore Ranks 10th Globally in Readiness for a Rapidly Ageing Society: Study by NUS and Columbia University /articles/singapore-ranks-10th-globally-in-readiness-for-a-rapidly-ageing-society-study-by-nus-and-columbia-university/?sc=c6277 /articles/singapore-ranks-10th-globally-in-readiness-for-a-rapidly-ageing-society-study-by-nus-and-columbia-university/?sc=c6277 Fri, 27 Dec 2024 05:45:15 EST All Journal News,Healthspan,Public Health Medical News Research Results Singapore has been ranked among the world's top 10 nations - and first in Asia - for its readiness to address the challenges and leverage the opportunities of an ageing population, according to a recent study conducted by researchers from the National University of Singapore (NUS) and Columbia University. National University of Singapore (NUS) By Looking at Individual Atoms in Tooth Enamel, UW and PNNL Researchers Are Learning What Happens to Our Teeth as We Age /articles/by-looking-at-individual-atoms-in-tooth-enamel-uw-and-pnnl-researchers-are-learning-what-happens-to-our-teeth-as-we-age/?sc=c6277 /articles/by-looking-at-individual-atoms-in-tooth-enamel-uw-and-pnnl-researchers-are-learning-what-happens-to-our-teeth-as-we-age/?sc=c6277 Thu, 19 Dec 2024 21:00:42 EST All Journal News,Healthcare,Healthspan,Oral Health,Grant Funded News,National Institutes of Health (NIH),Top Clipped Stories Medical News Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/19/67649e1f0dc45_AlternateSponsoredFellowGrimmJack-10.jpg&width=100&height=150" alt="Newswise image" />A research team at the University of Washington and the Pacific Northwest National Laboratory examined the atomic composition of enamel samples from two human teeth. /articles//images/uploads/2024/12/19/67649e1f0dc45_AlternateSponsoredFellowGrimmJack-10.jpg,/images/uploads/2024/12/19/67649e2e5670b_AtomprobeDevarajgrimm1.jpg University of Washington Rutgers Researcher Available to Discuss His Study Showing Impact of Tea and Coffee on Cognition & Dementia Risk /articles/rutgers-expert-available-to-discuss-impact-of-tea-and-coffee-on-cognition-and-dementia-risk/?sc=c6277 /articles/rutgers-expert-available-to-discuss-impact-of-tea-and-coffee-on-cognition-and-dementia-risk/?sc=c6277 Wed, 18 Dec 2024 18:40:28 EST Alzheimer's and Dementia,Food Science,Health Food,Healthspan,Neuro,Nutrition Medical News Expert Pitch Rutgers University-New Brunswick Good News for Seniors: Study Finds Antibiotics Not Linked to Dementia /articles/good-news-for-seniors-study-finds-antibiotics-not-linked-to-dementia/?sc=c6277 /articles/good-news-for-seniors-study-finds-antibiotics-not-linked-to-dementia/?sc=c6277 Wed, 18 Dec 2024 16:05:00 EST All Journal News,Alzheimer's and Dementia,Healthcare,Healthspan,Neuro,Neurology (journal),Top Clipped Stories Medical News Research Results For healthy older adults, using antibiotics is not associated with an increased risk of cognitive impairment or dementia, according to a study published in the December 18, 2024, online issue of Neurology(r), the medical journal of the American Academy of Neurology. American Academy of Neurology (AAN) Study Supports New Blood-Based Biomarker to Detect Early Brain Changes Leading to Cognitive Impairment and Dementia /articles/study-supports-new-blood-based-biomarker-to-detect-early-brain-changes-leading-to-cognitive-impairment-and-dementia/?sc=c6277 /articles/study-supports-new-blood-based-biomarker-to-detect-early-brain-changes-leading-to-cognitive-impairment-and-dementia/?sc=c6277 Wed, 18 Dec 2024 07:05:00 EST All Journal News,Alzheimer's and Dementia,Healthcare,Healthspan,Neuro,Grant Funded News,National Institutes of Health (NIH),Top Clipped Stories Medical News Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/16/676071af09ecc_CCSuperStock4128R-13022109.jpg&width=100&height=150" alt="Newswise image" />To identify and follow blood vessel-related changes in the brain that contribute to cognitive impairment and dementia, researchers and clinicians typically rely on MRI to evaluate "downstream" biological markers - those at the end of a cascade of events. But a multicenter study led by UCLA researchers could lead to a cost-effective blood test to identify changes occurring near the top of the chain, potentially identifying at-risk patients at an earlier stage. /articles//images/uploads/2024/12/16/676071af09ecc_CCSuperStock4128R-13022109.jpg University of California, Los Angeles (UCLA), Health Sciences Worsening Heat Waves Pose Unique Risks to People Living with Neurodegenerative Disease /articles/worsening-heat-waves-pose-unique-risks-to-people-living-with-neurodegenerative-disease/?sc=c6277 /articles/worsening-heat-waves-pose-unique-risks-to-people-living-with-neurodegenerative-disease/?sc=c6277 Tue, 17 Dec 2024 21:25:18 EST Alzheimer's and Dementia,Climate Science,Healthcare,Healthspan,Neuro,Parkinson’s Disease,Extreme Heat,All Journal News Medical News Op-Ed <img src="/legacy/image.php?image=/images/uploads/2024/12/17/6761c3d444eef_iStock-1420571004.jpg&width=100&height=150" alt="Newswise image" />As 2024 is set to end as Earth's hottest year on record - breaking the previous record set in 2023- a UCLA Health researcher says people living with neurodegenerative diseases will be uniquely vulnerable to worsening heat waves because of a higher risk of heat-related complications. /articles//images/uploads/2024/12/17/6761c3d444eef_iStock-1420571004.jpg University of California, Los Angeles (UCLA), Health Sciences BRAIN.ONE Brain Fitness Platform Announces Strategic Partnership with Acclaimed Thought Leader Tim Storey and Global Recovery Advocate Darren Prince /articles/brain-one-brain-fitness-platform-announces-strategic-partnership-with-acclaimed-thought-leader-tim-storey-and-global-recovery-advocate-darren-prince/?sc=c6277 /articles/brain-one-brain-fitness-platform-announces-strategic-partnership-with-acclaimed-thought-leader-tim-storey-and-global-recovery-advocate-darren-prince/?sc=c6277 Tue, 17 Dec 2024 20:10:27 EST Artificial Intelligence,Healthcare,Healthspan,Nutrition,Public Health,Technology Medical News,Science News Announcement BRAIN.ONE, a groundbreaking personalized brain fitness platform, is pleased to announce a partnership with renowned thought leader Tim Storey and the esteemed sports and celebrity agent Darren Prince, CEO of Prince Marketing Group. BRAIN.ONE, Inc. Expert Available on Mayo Clinic Research: Global Healthspan - Lifespan Gaps Among 183 World Health Organization Member States /articles/expert-available-on-mayo-clinic-research-global-healthspan-lifespan-gaps-among-183-world-health-organization-member-states/?sc=c6277 /articles/expert-available-on-mayo-clinic-research-global-healthspan-lifespan-gaps-among-183-world-health-organization-member-states/?sc=c6277 Tue, 17 Dec 2024 20:05:30 EST Health Disparities,Healthcare,Healthspan,Nutrition,Public Health Medical News Expert Pitch Hevolution Foundation Staying Sharp: Study Explores How Brain Changes May Affect Financial Skills /articles/staying-sharp-study-explores-how-brain-changes-may-affect-financial-skills/?sc=c6277 /articles/staying-sharp-study-explores-how-brain-changes-may-affect-financial-skills/?sc=c6277 Mon, 16 Dec 2024 20:50:05 EST All Journal News,Alzheimer's and Dementia,Cognition and Learning,Healthcare,Healthspan,Neuro Science News Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/16/67607bb6b6955_StayingsharpStudyexploreshowbrainchangesmayaffectfinancialskills.png&width=100&height=150" alt="Newswise image" />A new paper co-written by faculty at Binghamton University, State University of New York sheds light on how age-related changes may affect the way we handle finances -- and how we can stay sharp as we age. /articles//images/uploads/2024/12/16/67607bb6b6955_StayingsharpStudyexploreshowbrainchangesmayaffectfinancialskills.png,/images/uploads/2024/12/16/67607cd464a67_McDonoughIan.jpg Binghamton University, State University of New York Expert Available: Reduced Exposure to Sunlight Affects Our Circadian Rhythms and Health /articles/expert-available-reduced-exposure-to-sunlight-affects-our-circadian-rhythms-and-health/?sc=c6277 /articles/expert-available-reduced-exposure-to-sunlight-affects-our-circadian-rhythms-and-health/?sc=c6277 Mon, 16 Dec 2024 19:25:03 EST Healthcare,Healthspan,Public Health,Sleep Medical News Expert Pitch Rockefeller University Ditch TV and Read a Book: UniSA Research Delivers Best Moves to Reduce Dementia Risk /articles/ditch-tv-and-read-a-book-unisa-research-delivers-best-moves-to-reduce-dementia-risk/?sc=c6277 /articles/ditch-tv-and-read-a-book-unisa-research-delivers-best-moves-to-reduce-dementia-risk/?sc=c6277 Sun, 15 Dec 2024 14:30:46 EST All Journal News,Alzheimer's and Dementia,Cognition and Learning,Healthspan,Neuro,Top Hit Stories Medical News Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/11/6759217782fb1_ReadingabookGettyImages-175498359.jpg&width=100&height=150" alt="Newswise image" />It's that time of the year when most of us get the chance to sit back and enjoy some well-deserved down time. But whether you reach for the TV controller, or a favourite book, your choice could have implications for your long-term brain health, say researchers at the University of South Australia. /articles//images/uploads/2024/12/11/6759217782fb1_ReadingabookGettyImages-175498359.jpg University of South Australia UdeM Receives $8M to Study the Link Between the Immune System and Parkinson's Disease /articles/udem-receives-8m-to-study-the-link-between-the-immune-system-and-parkinson-s-disease/?sc=c6277 /articles/udem-receives-8m-to-study-the-link-between-the-immune-system-and-parkinson-s-disease/?sc=c6277 Fri, 13 Dec 2024 17:00:34 EST Budgets and Funding,Cell Biology,Healthcare,Healthspan,Immunology,Neuro,Parkinson’s Disease Medical News Announcement A team led by Michel Desjardins, a professor in the Faculty of Medicine, has secured $8M from ASAP to study the connection between the immune system and Parkinson's disease. Universite de Montreal Grant Will Fund Development of Vaccines to Prevent Dementia /articles/grant-will-fund-development-of-vaccines-to-prevent-dementia/?sc=c6277 /articles/grant-will-fund-development-of-vaccines-to-prevent-dementia/?sc=c6277 Thu, 12 Dec 2024 20:40:43 EST Alzheimer's and Dementia,Budgets and Funding,Healthspan,Neuro,Vaccines,Grant Funded News,National Institutes of Health (NIH) Medical News Announcement WashU researchers are working to design vaccines that could potentially prevent the buildup of inflammatory protein accumulations in the brain, which is one of the precursors to developing Alzheimer's disease Washington University in St. Louis With a Little Help From Their Friends: Poll Shows Role of Close Friendships in Older Adults' Health /articles/with-a-little-help-from-their-friends-poll-shows-role-of-close-friendships-in-older-adults-health/?sc=c6277 /articles/with-a-little-help-from-their-friends-poll-shows-role-of-close-friendships-in-older-adults-health/?sc=c6277 Thu, 12 Dec 2024 11:00:00 EST Healthcare,Healthspan,Mental Health,Psychology and Psychiatry,Top Hit Stories,Top Clipped Stories Medical News,Life News (Social and Behavioral Sciences) Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/11/6759fd8ed95ef_0414NPHA-Friendship02-social.png&width=100&height=150" alt="Newswise image" />Virtually all (90%) people over 50 say they have at least one close friend, while 10% say they do not, a new poll finds. But having no close friends was twice as common among people with worse health, whether mental or physical. /articles//images/uploads/2024/12/11/6759fd8ed95ef_0414NPHA-Friendship02-social.png Michigan Medicine - University of Michigan As Wildfires Intensify, Prolonged Exposure to Pollution Linked to Premature Death /articles/as-wildfires-intensify-prolonged-exposure-to-pollution-linked-to-premature-death/?sc=c6277 /articles/as-wildfires-intensify-prolonged-exposure-to-pollution-linked-to-premature-death/?sc=c6277 Thu, 12 Dec 2024 09:05:37 EST Climate Science,Environmental Health,Environmental Science,Healthcare,Healthspan,Pollution,Public Health,Wildfires,Top Hit Stories,Scientific Meetings Science News Research Results Researchers have found evidence that living in areas prone to wildfire smoke may negatively impact an individual's life expectancy. Ohio State University Fluctuating Blood Pressure Tied to Problems with Thinking Skills /articles/fluctuating-blood-pressure-tied-to-problems-with-thinking-skills/?sc=c6277 /articles/fluctuating-blood-pressure-tied-to-problems-with-thinking-skills/?sc=c6277 Wed, 11 Dec 2024 16:00:00 EST All Journal News,Alzheimer's and Dementia,Cognition and Learning,Healthcare,Healthspan,Neuro,Top Clipped Stories Medical News Research Results Older adults whose blood pressure fluctuates over time may be more likely to have problems with thinking and memory skills, according to a study published in the December 11, 2024, online issue of Neurology(r), the medical journal of the American Academy of Neurology. The association was found in Black participants but not in white participants in the study. American Academy of Neurology (AAN) Study Reveals How Unexpected Shifts in Cell Populations Are Revising Our Understanding of the Aging Process /articles/study-reveals-how-unexpected-shifts-in-cell-populations-are-revising-our-understanding-of-the-aging-process/?sc=c6277 /articles/study-reveals-how-unexpected-shifts-in-cell-populations-are-revising-our-understanding-of-the-aging-process/?sc=c6277 Wed, 11 Dec 2024 15:05:21 EST All Journal News,Cell Biology,Healthspan Medical News Research Results <img src="/legacy/image.php?image=/images/uploads/2024/12/11/6759f24f91097_20241211Caographicsizedforweb.png&width=100&height=150" alt="Newswise image" />A newly created atlas of 21 million cells could upend long-held assumptions about how we age and provide fresh directions for anti-aging therapies. /articles//images/uploads/2024/12/11/6759f24f91097_20241211Caographicsizedforweb.png Rockefeller University Grants Expand Roadway Safety Programs to Native American Youth and Older Drivers /articles/grants-expand-roadway-safety-programs-to-native-american-youth-and-older-drivers/?sc=c6277 /articles/grants-expand-roadway-safety-programs-to-native-american-youth-and-older-drivers/?sc=c6277 Wed, 11 Dec 2024 13:15:30 EST Budgets and Funding,Healthspan,Public Health,Travel and Transportation,National Infrastructure,Grant Funded News Life News (Social and Behavioral Sciences) Announcement <img src="/legacy/image.php?image=/images/uploads/2024/12/11/6759d6ecc7ea6_Hill-Linda-MD.jpg&width=100&height=150" alt="Newswise image" />The Herbert Wertheim School of Public Health and Human Longevity Science at University of California San Diego is creating programs to improve safety for all roadway users, including drivers, pedestrians and cyclists. With support from two grants from the California Office of Traffic Safety through the NHTSA, the school is developing an educational program geared towards Native American youth as well as new online courses to improve older driver safety. /articles//images/uploads/2024/12/11/6759d6ecc7ea6_Hill-Linda-MD.jpg,/images/uploads/2024/12/11/6759d73929acf_Moran-Ryan-MD-MPH.jpg University of California San Diego A divisao global entre uma vida mais longa e uma boa saude /articles/a-divis-o-global-entre-uma-vida-mais-longa-e-uma-boa-sa-de/?sc=c6277 /articles/a-divis-o-global-entre-uma-vida-mais-longa-e-uma-boa-sa-de/?sc=c6277 Wed, 11 Dec 2024 12:20:42 EST All Journal News,Healthcare,Healthspan,Public Health,JAMA Medical News Research Results Pessoas ao redor do mundo estao vivendo -- mas nao necessariamente mais saudaveis -- uma vida mais longa, de acordo com a pesquisa da Mayo Clinic. Um estudo com os 183 paises membros da Organizacao Mundial da Saude (OMS) descobriu que esses anos adicionais de vida estao cada vez mais associados a doencas. Mayo Clinic الفجوة العالمية بين طول الحياة وطول العمر الصحي /پ/الفجوة-العالمية-بين-طول-الحياة-وطول-العمر-الصحي/?=6277 /پ/الفجوة-العالمية-بين-طول-الحياة-وطول-العمر-الصحي/?=6277 Wed, 11 Dec 2024 12:20:30 EST All Journal News,Healthcare,Healthspan,Public Health,JAMA Medical News Research Results يعيش الأشخاص حول العالم حياة أطول -- ولكن ليس بالضرورة أكثر صحة -- وذلك وفقًا لبحث أجرته مايو كلينك. وجدت دراسة ضمت 183 دولة من الدول الأعضاء في منظمة الصحة العالمية أن تلك السنوات الإضافية للحياة تكون حافلة بالأمراض. ويوثق هذا البحث الذي أجراه أندريه تيرزيتش، دكتور في الطب، وحاصل على الدكتوراه، وأرمين جارماني هذه الفجوة الآخذة في الاتساع بين العمر الافتراضي والعمر الصحي. وقد نُشرت هذه الورقة البحثية في المجلة الطبية JAMA Network Open "شبكة مجلة الجمعية الطبية الأمريكية المفتوحة". Mayo Clinic